Tetraspanin-13 is a protein that in humans is encoded by the TSPAN13 gene. The encoded protein is a 204 amino acid protein with a predicted molecular weight of 24 kDa. It is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. This protein is involved in the mediation of signal transduction.
Basic Information of TSPAN13 | |
Protein Name | Tetraspanin-13 |
Gene Name | TSPAN13 |
Aliases | Tspan-13, Tetraspan NET-6, Transmembrane 4 superfamily member 13, NET6, TM4SF13, UNQ260/PRO296 |
Organism | Homo sapiens (Human) |
UniProt ID | O95857 |
Transmembrane Times | 4 |
Length (aa) | 204 |
Sequence | MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL |
Tetraspanins are a group of evolutionary conserved transmembrane proteins that are found in all multicellular organisms. They have been thought to act as central organizers of membrane complexes and promote a variety of biological processes, such as cell proliferation, movement, adhesion, and fusion. TSPAN13, a member of the tetraspanin family, is a key mediator in diverse signal transduction events, involved in the regulation of cell development, activation, growth, and motility. TSPAN13 has bee reported to be associated with the progression of cancer. The TSPAN13 levels are lowest in breast cancer cells displaying an aggressive phenotype, particularly in ER-/HER2- and high-grade carcinomas TSPAN13. Knocking down of TSPAN13 in breast cancer cells promote the apoptosis of the cells. In a human osteosarcoma cell line U2OS, TSPAN13 knockdown reduces cell viability, clonogenic efficiency and cell migration potential, and enhances the apoptosis of cells.
Fig.1 Schematic representation of animal and plant tetraspanin topologies. (Leonor, 2013)
This article suggests that TSAPN13 knockdown in hTERT overexpressing U2OS cells promotes the apoptosis of the cells.
This investigation indicates that TSPAN13-to-S100A9 ratio may be regarded as a diagnostic marker for prostate cancer. Evaluation of the TSPAN13-to-S100A9 ratio of urine supernatant is expected to be a simple diagnostic method for prostate cancer.
This study reveals that TSPAN-13 may be involved in the regulation of CaV2.2 Ca2+ channel activity in defined synaptic membrane compartments, thereby influencing transmitter release.
This article shows that TSPAN-13 are overexpressed in prostate cancer, suggesting TSPAN-13 may have an important role in the progression of prostate cancer.
The experimental results show that NET-6, also known as TSPAN-13, has an antiproliferative activity and is regarded as a potential novel breast cancer suppressor.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TSPAN13 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
USA:
Europe: Germany: |
|
Call us at: USA: UK: Germany: |
|
Fax:
|
|
Email: info@creative-biolabs.com |