ADGRE2 Membrane Protein Introduction

Introduction of ADGRE2

ADGRE2, also known as EGF-like module receptor 2 (EMR2) or EGF-like module-containing mucin-like hormone receptor-like 2, is a protein encoded by the human ADGRE2 gene. As a member of the adhesion GPCR family, it is characterized by an extended extracellular region often possessing N-terminal protein modules that are linked to a TM7 region via a domain known as the GPCR-Autoproteolysis Inducing (GAIN) domain.

Basic Information of ADGRE2
Protein Name	Adhesion G protein-coupled receptor E2
Gene Name	ADGRE2
Aliases	EGF-like module receptor 2, EGF-like module-containing mucin-like hormone receptor-like 2, CD antigen CD312
Organism	Homo sapiens (Human)
UniProt ID	Q9UHX3
Transmembrane Times	7
Length (aa)	823
Sequence	MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINE CATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTL GSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVC EDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSR FFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSN GLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQN GCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLL CKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARN LTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNL VLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQ GVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN

Function of ADGRE2 Membrane Protein

During the past years, ADGRE2 has been widely studied. It has been reported that ADGRE2 is closely related to CD97 with 97% amino-acid identity in the EGF-like domains. As a member of the adhesion GPCR family, ADGRE2 is expressed by monocytes/macrophages, dendritic cells and all types of granulocytes. And it is rarely expressed by tumor cell lines and tumors, but has been found on breast and colorectal adenocarcinoma. Recently, the role of ADGRE2 in the migration and adhesion of myeloid cell during cell differentiation, maturation, and activation has been widely studied. It has suggested that the ligation of EMR2 could increase neutrophil adhesion, migration and anti-microbial mediator production and could enhance the systemic inflammation. What’s more, other studies had shown that EMR2 expression on the neutrophil increased in patients with SIRS and correlated with the extent of organ failure.

Fig.1 ADGRE2 protein domains.

Application of ADGRE2 Membrane Protein in Literature

1. Huang YS, et.al. Membrane-association of EMR2/ADGRE2-NTF is regulated by site-specific N-glycosylation. Scientific reports. 2018, 8(1): 4532. PubMed ID: 29540735

This article provides a novel insight into the complex interaction and activation mechanisms of aGPCRs.

2. Huang YS, et.al. Activation of Adhesion GPCR EMR2/ADGRE2 Induces Macrophage Differentiation and Inflammatory Responses via Gα16/Akt/MAPK/NF-κB Signaling Pathways. Frontiers in immunology. 2017, 8: 373. PubMed ID: 28421075

This article reveals that ADGRE2 has a new role in the differentiation and inflammatory activation of human monocytic cells and provide potential targets for myeloid cell-mediated inflammatory disorders.

3. Boyden SE, et.al. Vibratory urticaria associated with a missense variant in ADGRE2. New England Journal of Medicine. 2016, 374(7): 656-63. PubMed ID: 26841242

This article suggests that the variant probably destabilizes an autoinhibitory subunit interaction, sensitizing mast cells to IgE-independent vibration-induced degranulation.

4. Feliciano A, et.al. miR-99a reveals two novel oncogenic proteins E2F2 and EMR2 and represses stemness in lung cancer. Cell death & disease. 2017, 8(10): e3141. PubMed ID: 29072692

This article reveals that EMR2 plays a key role in lung tumorigenesis. By inhibiting E2F2 and EMR2, miR-99a represses in vivo the transition of epithelial cells through an EMT process concomitantly with the inhibition of stemness features and consequently decreasing the CSC population.

5. Burzava AL, et.al. Affinity binding of EMR2 expressing cells by surface-grafted chondroitin sulfate B. Biomacromolecules. 2017, 18(6): 1697-704. PubMed ID: 28437084

This article suggests that the EMR2 expressing human myeloid cell line U937 preferentially bound onto CS-B-modified substrates, and U937 cells preincubated with CS-B in solution exhibited reduced affinity for the substrate.

ADGRE2 Preparation Options

Having worked in the field of membrane protein preparation for many years, Creative Biolabs has successfully developed versatile Magic™ membrane protein production platform that can provide a variety of flexible options. Our professional scientists will do their best to help you choose a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRE2 antibody development services.

Over years Creative Biolabs has successfully provided a series of membrane protein preparation services. We are happy to share our one-stop, custom-oriented service packages with global customers. If you are interested in the service we can provide, please feel free to contact us and get more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: