ADGRE3 Membrane Protein Introduction

Introduction of ADGRE3

ADGRE3, also known as EGF-like module receptor 3 (EMR3) or EGF-like module-containing mucin-like hormone receptor-like 3, is a protein encoded by the human ADGRE3 gene. As a member of the adhesion GPCR family, ADGRE3 is expressed at the cell surface as a heterodimeric molecule consisting of a long extracellular α-chain, which possesses an N-terminus EGF-like domain and a membrane-spanning β-chain.

Basic Information of ADGRE3
Protein Name	Adhesion G protein-coupled receptor E3
Gene Name	ADGRE3
Aliases	EGF-like module receptor 3, EGF-like module-containing mucin-like hormone receptor-like 3
Organism	Homo sapiens (Human)
UniProt ID	Q9BY15
Transmembrane Times	7
Length (aa)	652
Sequence	MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINE CTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFE SLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTF NLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNV SLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQ EEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLY GTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFI LGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSS KMGPDSKPSEGDVFPGQVKRKY

Function of ADGRE3 Membrane Protein

ADGRE3 is a poorly characterized EGF-TM7 receptor which possesses two EGF domains and has been suggested to bind a ligand at the surface of monocyte-derived macrophages and activated neutrophils. It is remarkable that the TM7 region of ADGRE3 is highly similar to that of EMR2, and in fact, EMR3 was discovered unintentionally as a PCR co-amplification product during the cDNA cloning of EMR2. Studies have shown that the expression of ADGRE3 is restricted to mature monocytes/macrophages, myeloid dendritic cells, and mature granulocytes in human. Although the cellular distribution of EMR3 partially overlaps with that of CD97 and EMR2, it is absent from hematopoietic stem and progenitor cells. What’s more, it has been reported that ADGRE3 plays a role in myeloid-myeloid interactions during immune and inflammatory responses.

Fig.1 Diversity of G-protein-coupled receptor signaling. (Dorsam, et.al. 2007)

Application of ADGRE3 Membrane Protein in Literature

1. Kane AJ, et.al. EMR3: A Potential Mediator of Invasive Phenotypic Variation in Glioblastoma and Novel Therapeutic Target. Neuroreport. 2010, 21(16): 1018-22. PubMed ID: 20827226

This article reveals that EMR-3 is variably expressed in primary human glioblastoma tissues and cell lines. Knocking down EMR-3 has no impact on cellular proliferation, but decreases cellular invasion by greater than 3-fold. It indicates that EMR-3 may be used as a potential therapeutic target for glioma.

2. Matmati M, et.al. The human EGF-TM7 receptor EMR3 is a marker for mature granulocytes. Journal of leukocyte biology. 2007, 81(2): 440. PubMed ID: 17108056

This article reveals that the expression of EGF-TM7 receptors on myeloid cells is differentially regulated. EMR3 is the first family member found mainly on granulocytes.

3. Stacey M, et.al. Human epidermal growth factor (EGF) module-containing mucin-like hormone receptor 3 is a new member of the EGF-TM7 family that recognizes a ligand on human macrophages and activated neutrophils. Journal of Biological Chemistry. 2001, 276(22): 18863-70. PubMed ID: 11279179

This article suggests that EMR3 plays a role in myeloid-myeloid interactions during immune and inflammatory responses.

ADGRE3 Preparation Options

With years of experience and advanced Magic™ membrane protein production platform, Creative Biolabs is able to provide professional membrane protein preparation services for global customers. Our professional scientists are happy to help you choose an ideal method for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRE3 antibody development services.

Creative Biolabs is committed to providing professional membrane protein production service for worldwide customers. Based on years of experience, our service can be accomplished by a variety of strategies. We promise every client will be presented with the most qualified and tailored service. For more detailed information, please feel free to contact us.

Reference

Dorsam, et.al. (2007). G-protein-coupled receptors and cancer. Nature reviews cancer, 7(2), 79.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: