Introduction of GPR15
GPR15 is encoded by the GPR15 gene which is mapped to human chromosome 3q11.2-q13.1 and the mass of GPR15 is 40,787 Da in human. It belongs to the G-protein-coupled receptor (GPCR) family which represents the largest class of cell surface receptors and play an integral role in an enormous array of biological pathways. Besides, GPR15/BOB exhibits the primary structure of a 7-transmembrane domain protein and shares sequence identity with regions of the angiotensin II receptor and GPCRs CXCR2, CXCR4, CCR5, DEZ (chemerin receptor), GPR1 and APJ (apelin receptor).
Basic Information of GPR15 | |
Protein Name | G-protein coupled receptor 15 |
Gene Name | GPR15 |
Aliases | Brother of Bonzo, BoB |
Organism | Homo sapiens (Human) |
UniProt ID | P49685 |
Transmembrane Times | 7 |
Length (aa) | 360 |
Sequence | MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL |
Function of GPR15 Membrane Protein
The activity of GPR15 is mediated by G proteins, resulting in the activation of adenylyl cyclase and elevating intracellular cAMP. GPR15/BOB is a co-receptor for simian immunodeficiency virus (SIV) and human immunodeficiency virus types 1 and 2 (HIV-1 and HIV-2). The majority of HIV-2 envelope glycoproteins and a minority of HIV-1 envelope glycoproteins can use GPR15 as a co-receptor and SIV uses GPR15/BOB to infect cell lines transfected to express the receptor. GPR15/BOB is expressed on several human B and T cell lines including the T/B cell hybrid cell line CEMx174. Besides, GPR15/BOB is expressed by macrophages in synovial tissue and on monocytes and neutrophils in peripheral blood, and expression is up-regulated in RA patients compared to non-RA controls. This orphan receptor, GPR150, on monocytes/macrophages and neutrophils may play a role in RA pathophysiology. What’s more, it has been shown that GPR15 controls homing of regulatory T cells specifically to the large intestine mucosa and thereby regulates local immune homeostasis.
Fig.1 GPR15/Bob-mediated signal transduction (Maresca, 2003).
Application of GPR15 Membrane Protein in Literature
This article reports that the degree of GPR15-expressing cells among T cells as well as the methylation at cg05575921 in granulocytes in blood are both rather signs of tobacco-smoking induced systemic inflammation because they don’t indicate specifically non-cancerous pathological changes in the lungs.
This article reveals that identification of the chemotactic activity of GPR15L adds to its reported antibacterial and tumor cell growth regulatory functions and suggests the potential of targeting GPR15L-GPR15 interactions for modulation of mucosal and cutaneous inflammation.
This article describes a T cell-homing receptor for LILP and indicates that GPR15 plays a role in mucosal immune tolerance largely by regulating the influx of regulatory T cells.
Authors of this article find that HIV-2 isolates from aviremic individuals commonly use as coreceptors CCR5, GPR15, and CXCR6, as well as an unidentified receptor expressed by U87 cells.
This article reports that GPR15 is an inefficient infection-inducing co-receptor, it mediates viral strain-specific gp120-induced calcium signaling at low, physiologically reasonable gp120 concentrations, up to 10,000-fold lower gp120 concentrations than the principal co-receptors. Gp120-induced GPR15 activation is a plausible cause of HIV enteropathy.
GPR15 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR15 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.