Close

Magic™ Membrane Protein Mouse Nox3 (NADPH oxidase 3) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2823K)

This product is a Mouse Nox3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Nox3
  • Protein Length
  • Full Length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 6
  • Sequence
  • MPVCWILNESGSFVVALLWLAVNAYLFIDTFFWYTEEEAFFYTRVILGSALAWARASAVCLNFNCMLILLPVSRNFISLVRGTSVCCRGPWRRQLDKNLNFHKLVAYGIAVNSVIHIVAHLFNLERYHLGQAKDAEGLLAALSKLGDAPNESYLNPVRTFDMGTTTELLMTVSGITGLGISLALVFIMTSSTEFIRRSSYELFWYTHHIFVFFFISLAIHGGGRIIRGQTPESLRLHNVTYCRDHYAEWQAAALCPVPQFSGKEPSAWKWALGPVVLYACERIIRFWRSHQEVVITKVVSHPSAVLELHMKKRDFKMAPGQYIFIQCPSVSPLEWHPFTLTSAPQEDFFSVHIRASGDWTEALLKAFRVEGQAPSELCSMPRLAVDGPFGGSLADVFHYPVSVCIATGIGVTPFASLLKSVWYKCCESQSLPELSKVYFYWICRDAGAFEWFADLLLSLETRMSEQGKAHLLSYHIYLTGWDENQAIHIALHWDESLDVITGLKQKAFYGRPNWNDEFKQIAYNHPSSSIGVFFCGSKAMSKTLQKMCRLYSSVDPRGVHFYYNKENF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Nox3
  • Full Name
  • NADPH oxidase 3
  • Introduction
  • This gene encodes a member of the NOX family of NADPH oxidases. These enzymes catalyze the transfer of electrons from NADPH to molecular oxygen to produce superoxide and other reactive oxygen species (ROS). The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia, which are crystalline structures of the inner ear involved in the perception of gravity and linear acceleration. In mouse mutations of this gene lead to the absence of otoconia and vestibular dysfunction.
  • Alternative Names
  • Nox3; het; nmf25; GP91-3; nmf250; head-tilt; NADPH oxidase 3

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us