Close

Magic™ Membrane Protein Human COX6B1 (Cytochrome c oxidase subunit 6B1) Expressed in Wheat germ, Full Length (CAT#: MPX0081K)

This product is a 35 kDa Human COX6B1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • COX6B1
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • Molecular Weight
  • 35 kDa
  • Sequence
  • MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.3% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • COX6B1
  • Full Name
  • Cytochrome c oxidase subunit 6B1
  • Introduction
  • Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.
  • Alternative Names
  • COX6B1; COXG; COX6B; MC4DN7; COXVIb1; cytochrome c oxidase subunit 6B1; COX VIb-1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); Cytochrome c oxidase subunit 6B1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us