Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
This product is a made-to-order Human OR10AG1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.
Product Specifications
Host Species
Human
Target Protein
OR10AG1
Protein Length
Full length
Protein Class
GPCR
TMD
7
Sequence
MEFVLLGFSDIPNLHWMLFSIFLLMYLMILMCNGIIILLIKIHPALQTPM YFFLSNFSLLEICYVTIIIPRMLMDIWTQKGNISLFACATQMCFFLMLGG TECLLLTVMAYDRYVAICKPLQYPLVMNHKVCIQLIIASWTITIPVVIGE TCQIFLLPFCGTNTINHFFCDIPPILKLACGNIFVNEITVHVVAVVFITV PFLLIVVSYGKIISNILKLSSARGKAKAFSTCSSHLIVVILFFGAGTITY LQPKPHQFQRMGKLISLFYTILIPTLNPIIYTLRNKDIMVALRKLLAKLL T
Product Description
Expression Systems
Baculovirus/Insect expression system
Tag
Flag-StrepII or based on specific requirements
Protein Format
Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)
Target
Target Protein
OR10AG1
Full Name
Olfactory receptor family 10 subfamily AG member 1
Introduction
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Alternative Names
OR10AG1; OR11-160; olfactory receptor 10AG1; olfactory receptor OR11-160; Olfactory receptor family 10 subfamily AG member 1