PTGER1 Membrane Protein Introduction

Introduction of PTGER1

PTGER1, also known as Prostaglandin E2 receptor 1 (EP1), is a 42 kDa prostaglandin receptor encoded by the PTGER1 gene. EP1 is one of four identified EP receptors, EP1, EP2, EP3, and EP4 which bind with and mediate cellular responses principally to (prostaglandin E2) (PGE2) and also with lesser affinity and responsiveness to other prostanoids. Animal model studies have implicated EP1 in various physiological and pathological responses. However, key differences in the distribution of EP1 between these test animals and humans as well as other complicating issues make it difficult to establish the function(s) of this receptor in human health and disease.

Basic Information of PTGER1
Protein Name	Prostaglandin E2 receptor EP1 subtype
Gene Name	PTGER1
Aliases	Prostaglandin E2 receptor EP1 subtype, PGE receptor EP1 subtype, PGE2 receptor EP1 subtype, Prostanoid EP1 receptor
Organism	Homo sapiens (Human)
UniProt ID	P34995
Transmembrane Times	7
Length (aa)	402
Sequence	MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF

Function of PTGER1 Membrane Protein

This PTGER1 receptor is PGE2, which serves several functions. PGE2 can mediate hyperalgesia. It causes increased pain perception when administered into the central nervous system but inhibits pain perception when administered systemically. It not only promotes colon cancer development in Azoxymethane-induced and APC gene knockout mice, but also promotes hypertension in diabetic mice and spontaneously hypertensive rats. In addition, it may be differentially involved in etiology of acute brain injuries. Pharmacological inhibition or genetic deletion of EP1 receptor produce beneficial of deleterious effects in rodent models of neurological disorders, such as ischemic stroke, epileptic seizure, surgically induced brain injury and traumatic brain injury.

PTGER1 Membrane Protein Introduction

Application of PTGER1 Membrane Protein in Literature

Zhu J., et al. Prostaglandin E2 receptor EP1 in healthy and diseased human endometrium. Histochem Cell Biol. 2018, 149(2): 153-160. PubMed: 29134301.

This article explores the underlying mechanisms that affect the growth and function of endometrial epithelium and stroma by assessing the staining intensity of PGE2 receptors (EP) in healthy endometrium across the menstrual cycle and in pathological endometrium, such as ovarian endometriosis and endometrial cancer.
Jin J., et al. Prostanoid EP1 receptor as the target of (-)-epigallocatechin-3-gallate in suppressing hepatocellular carcinoma cells in vitro. Acta Pharmacol Sin. 2012, 33(5): 701. PubMed: 22555372.

The article suggests that the anti-HCC effects of EGCG might be mediated, at least partially, through the suppressing EP(1) receptor expression and PGE(2) production.
Cui H., et al. Association study of EP1 gene polymorphisms with suicide completers in the Japanese population. Prog Neuropsychopharmacol Biol Psychiatr. 2011, 35(4): 1108-1111. PubMed: 21447366.

The article carries out an association study of EP1 gene polymorphisms with suicide completers in the Japanese population. They could not find an association of EP1 gene with suicide in the Japanese population.
Ma X., et al. Prostaglandin E receptor EP1 suppresses breast cancer metastasis and is linked to survival differences and cancer disparities. Mol Cancer Res. 2010: 1541-7786. PubMed: 20858737.

This article suggests that a role for EP1 in metastasis and EP1 functions as a metastasis suppressor and that loss of nuclear EP1 is associated with poorer overall survival and may contribute to disparities in outcome in different populations.
Konger R.L., et al. The EP1 subtype of prostaglandin E2 receptor: role in keratinocyte differentiation and expression in non-melanoma skin cancer. Prostaglandins Leukot Essent Fatty Acids. 2009, 81(4): 279-290. PubMed:19625175.

The article supports a role for the EP1 receptor in regulating keratinocyte differentiation. And the PTGER1 is expressed in the differentiated compartment of the normal human epidermis and is coupled to intracellular calcium mobilization.

PTGER1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-PTGER1 antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: