Rabbit Anti-Human Complement Factor D Polyclonal Antibody(Cat#: CTA-348)

This product is an unconjugated anti-Human Complement Factor D Polyclonal antibody generated from the Rabbit. The antibody can be used for WB.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG
Species Reactivity Human
Applications WB
Application Notes WB: 1:1000
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement Factor D.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 20; 100 µL
Storage Store at -20°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name Factor D
Alternative Names Properdin Factor D; D Component Of Complement (Adipsin); C3 Convertase Activator; Adipsin; Complement Factor D Preproprotein; Complement Factor D (Adipsin); EC 3.4.21.46; ADIPSIN; AND; PFD; DF
Gene ID 1675
UniProt ID P00746
Information
Introduction Complement factor D is a protein which in humans is encoded by the CFD gene. Factor D is involved in the alternative complement pathway of the complement system where it cleaves factor B. This protein is also a serine protease that is secreted by adipocytes into the bloodstream.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry