There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
1 mg | ||
500 μg | ||
100 μg |
Product Overview | Recombinant Bovine coronavirus (BCoV) Spike glycoprotein (326-540 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | Yeast |
Species | Bovine coronavirus (BCoV) |
Fragment | 326-540 aa |
Sequence | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT |
Tag | 6xHis-tag at the N-terminus |
Predicted MW | 25.7 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | S |
Full Name | Spike glycoprotein |
Uniprot ID | P25194 |
Background | Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. |
Alternate Names | E2; Peplomer protein |