Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bovine coronavirus (strain LSU-94LSS-051) Spike glycoprotein (S) (314-634 aa) [His-Tag], Mammalian cell (CAT#: GP02-104J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Bovine coronavirus (strain LSU-94LSS-051) Spike glycoprotein (314-634 aa) was expressed in Mammalian cell with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Mammalian cell
Species Bovine coronavirus (strain LSU-94LSS-051)
Fragment 314-634 aa
Sequence TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag 6xHis-tag at the C-terminus
Predicted MW 37.2 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Spike glycoprotein
Uniprot ID Q9QAR5
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names S glycoprotein; E13; Peplomer protein; S
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on
ISO 9001 Certified - Creative Biolabs Quality Management System.
Advertisement