0

Inquiry Basket

There is no product in the shopping cart, buy it!

Glyco-engineered Mammalian Cell Expression System Learn More

Knockout and Knockin by Precision Genome Editing Service Learn More

High-throughput Glycan Screening Service Learn More

Recombinant Bovine coronavirus (strain LSU-94LSS-051) Spike glycoprotein (S) (314-634 aa) [His-Tag], Mammalian cell (CAT#: GP02-104J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Specifications

Product Overview	Recombinant Bovine coronavirus (strain LSU-94LSS-051) Spike glycoprotein (314-634 aa) was expressed in Mammalian cell with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Mammalian cell
Species	Bovine coronavirus (strain LSU-94LSS-051)
Fragment	314-634 aa
Sequence	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag	6xHis-tag at the C-terminus
Predicted MW	37.2 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target Information

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q9QAR5
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E13; Peplomer protein; S

Related products

Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-263-EB-J)
Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), Baculovirus (CAT#: GPX-045-B-J)
Recombinant Bovine coronavirus (strain LY-138) Spike glycoprotein (S) (314-634 aa) [His-Tag], Yeast (CAT#: GP02-094J)
Recombinant Avian infectious bronchitis virus (strain UK/167/84) (IBV) Spike glycoprotein (S), Baculovirus (CAT#: GPX-263-B-J)
Recombinant Human Surface glycoprotein (S) (16-685 aa (N501Y, P681H)) [mFC-Tag], Mammalian cell (CAT#: GP02-121J)
Recombinant Murine coronavirus (strain JHM) (MHV-JHM) Spike glycoprotein (S), Baculovirus (CAT#: GPX-113-B-J)
Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), E. coli (CAT#: GPX-045-E-J)
Recombinant Human coronavirus NL63 (HCoV-NL63) Spike glycoprotein (S) (210-716 aa) [His-PDI-Tag], Yeast (CAT#: GP02-089J)

For Research Use Only.

Online Inquiry

(USA)
(UK)
(Germany)
Contact Us
Global Locations

Follow us on

(USA)
(UK)
(Germany)

Global Locations

ISO 9001 Certified - Creative Biolabs Quality Management System.

Advertisement