Recombinant Human coronavirus 229E (HCoV-229E) Surface glycoprotein (S) (785-873 aa) [His/Myc-Tag], E. coli (CAT#: GP02-087J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Human coronavirus 229E (HCoV-229E) Surface glycoprotein (785-873 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human coronavirus 229E (HCoV-229E)
Fragment	785-873 aa
Sequence	DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTIQ
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	17.2 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Surface glycoprotein
Gene ID	918758
Uniprot ID	P15423
Background	S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Alternate Names	S glycoprotein; E2; Peplomer protein; S

Recombinant Murine coronavirus (strain A59) (MHV-A59) Spike glycoprotein (S), E. coli (CAT#: GPX-112-E-J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (16-685 aa) [Avi-tag ylated], Mammalian cell (CAT#: GP02-125J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (N501Y) [His-mFc-Tag], Mammalian cell (CAT#: GP02-130J)
Recombinant Avian infectious bronchitis virus (strain UK/142/86) (IBV) Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-262-EB-J)
Recombinant Avian infectious bronchitis virus (strain UK/167/84) (IBV) Spike glycoprotein (S), E. coli (CAT#: GPX-263-E-J)
Recombinant Bovine coronavirus (strain LY-138) Spike glycoprotein (S) (314-634 aa) [His-Tag], Yeast (CAT#: GP02-094J)
Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), Yeast (CAT#: GPX-045-Y-J)
Recombinant Bat coronavirus 133/2005 (BtCoV) Spike glycoprotein (S) (372-611 aa) [His/Myc-Tag], E. coli (CAT#: GP02-099J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications