Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (S) (310-622 aa) [mFC-Tag], Mammalian cell (CAT#: GP02-113J)

Datasheet

Size	Qty	Add To Basket
100 μg
500 μg

Product Overview	Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (310-622 aa) was expressed in Mammalian cell with a mFC-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Mammalian cell
Species	Human coronavirus HKU1 (isolate N5)
Fragment	310-622 aa
Sequence	TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNLSSYDVVYSDHCFSVNSDFCPCADPSVVNSCAKSKPPSAICPAGTKYRHCDLDTTLYVKNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCFCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEISTGVCVNY
Tag	mFC-tag at the C-terminus
Predicted MW	64.1 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q0ZME7
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E2; Peplomer protein

Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), Yeast (CAT#: GPX-045-Y-J)
Recombinant Avian infectious bronchitis virus (strain KB8523) (IBV) Spike glycoprotein (S), E. coli (CAT#: GPX-142-E-J)
Recombinant Avian infectious bronchitis virus (strain D274) (IBV) Spike glycoprotein (S), Baculovirus (CAT#: GPX-144-B-J)
Recombinant Human coronavirus HKU1 (isolate N2) Spike glycoprotein (S) (310-622 aa) [His-Tag], E. coli (CAT#: GP02-091J)
Recombinant SARS-CoV-2 Surface glycoprotein (Met1-Asn21) [hFc tag], CHO (CAT#: GP05-052J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (W436R) [His-Tag], Mammalian cell (CAT#: GP02-135J)
Recombinant SARS coronavirus Tor2 Spike glycoprotein RBD (Arg306-Phe527) [hFc tagCHO (CAT#: GP05-382J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) [mFc-Avi-Tag], Mammalian cell (CAT#: GP02-129J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications