0

Inquiry Basket

There is no product in the shopping cart, buy it!

Glyco-engineered Mammalian Cell Expression System Learn More

Knockout and Knockin by Precision Genome Editing Service Learn More

High-throughput Glycan Screening Service Learn More

Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (S) (318-624 aa) [His-Tag], E. coli (CAT#: GP02-093J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Specifications

Product Overview	Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (318-624 aa) was expressed in E. coli with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human coronavirus OC43 (HCoV-OC43)
Fragment	318-624 aa
Sequence	TVQPIADVYRRKPNLPNCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNFCPCKLNGSCVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGTYKCPQTKSLVGIGEHCSGLAVKSDYCGGNSCTCRPQAFLGWSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGVCVNY
Tag	6xHis-tag at the C-terminus
Predicted MW	34.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target Information

Target	S
Full Name	Spike glycoprotein
Uniprot ID	P36334
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E5; Peplomer protein; S

Related products

Recombinant Human Surface glycoprotein (S) (16-685 aa (N501Y, P681H)) [mFC-Tag], Mammalian cell (CAT#: GP02-121J)
Recombinant SARS-CoV Spike glycoprotein (S), Baculovirus (CAT#: GPX-330-B-J)
Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (S) (310-622 aa) [His-Tag], E. coli (CAT#: GP02-096J)
Recombinant Avian infectious bronchitis virus (strain D274) (IBV) Spike glycoprotein (S), Yeast (CAT#: GPX-144-Y-J)
Recombinant Avian infectious bronchitis virus (strain M41) (IBV) Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-143-EB-J)
Recombinant SARS-CoV Spike glycoprotein (S), Yeast (CAT#: GPX-330-Y-J)
Recombinant SARS-CoV Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-330-EB-J)
Recombinant Murine coronavirus (strain 4) (MHV-4) Spike glycoprotein (S), E. coli (CAT#: GPX-211-E-J)

For Research Use Only.

Online Inquiry

(USA)
(UK)
(Germany)
Contact Us
Global Locations

Follow us on

(USA)
(UK)
(Germany)

Global Locations

ISO 9001 Certified - Creative Biolabs Quality Management System.

Advertisement