Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (S) (15-344 aa) [His/Myc-Tag], Baculovirus (CAT#: GP02-114J)

Datasheet

Size	Qty	Add To Basket
100 μg
500 μg

Product Overview	Recombinant Human coronavirus OC43 (HCoV-OC43) Spike glycoprotein (15-344 aa) was expressed in Baculovirus with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Baculovirus
Species	Human coronavirus OC43 (HCoV-OC43)
Fragment	15-344 aa
Sequence	VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	41.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	P36334
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E2; Peplomer protein

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S) (310-514 aa) [His-Tag], Baculovirus (CAT#: GP02-115J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (G476S) [His-Tag], Mammalian cell (CAT#: GP02-136J)
Recombinant Avian infectious bronchitis virus (strain D3896) (IBV) Spike glycoprotein (S), E. coli (CAT#: GPX-173-E-J)
Recombinant Avian infectious bronchitis virus (strain D274) (IBV) Spike glycoprotein (S), Baculovirus (CAT#: GPX-144-B-J)
Recombinant Murine coronavirus (strain A59) (MHV-A59) Spike glycoprotein (S), Yeast (CAT#: GPX-112-Y-J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (16-685 aa) [Avi-tag ylated], Mammalian cell (CAT#: GP02-125J)
Recombinant Betacoronavirus England 1 Spike glycoprotein RBD (Glu367-Tyr606) [His tag], CHO (CAT#: GP05-097J)
Recombinant Avian infectious bronchitis virus (strain KB8523) (IBV) Spike glycoprotein (S), Mammalian cell (CAT#: GPX-142-M-J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications