There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
1 mg | ||
500 μg | ||
100 μg |
Product Overview | Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein L (23-137 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Human herpesvirus 4 (HHV-4) (strain B95-8) |
Fragment | 23-137 aa |
Sequence | NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG |
Tag | 6xHis-SUMO-tag at the N-terminus |
Predicted MW | 28.7 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | gL |
Full Name | Envelope glycoprotein L |
Gene ID | 3783710 |
Uniprot ID | P03212 |
Background | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. |
Alternate Names | Envelope glycoprotein L |