Recombinant Human herpesvirus 5 (HHV-5) (strain AD169) Envelope glycoprotein H (gH) (24-195 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-198J)

Datasheet

Product Overview	Recombinant Human herpesvirus 5 (HHV-5) (strain AD169) Envelope glycoprotein H (24-195 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 5 (HHV-5) (strain AD169)
Fragment	24-195 aa
Sequence	RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	35.8 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gH
Full Name	Envelope glycoprotein H
Uniprot ID	P12824
Background	The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Alternate Names	gH; UL75

Recombinant Human herpesvirus 4 (HHV-4) (strain GD1) Envelope glycoprotein H (gH) (19-706 aa), E. coli (CAT#: GPX04-196J)
Recombinant Pseudorabies virus (strain Rice) Envelope glycoprotein H (31-686 aa), E. coli (CAT#: GP05-356J)
Recombinant Marek's disease herpesvirus type 1 Envelope glycoprotein H (19-813 aa), E. coli (CAT#: GP05-312J)
Recombinant Pacheco's disease virus Envelope glycoprotein H (41-806 aa), E. coli (CAT#: GP05-335J)
Recombinant Meleagrid herpesvirus 1 (MeHV-1) Envelope glycoprotein H (gH) (18-808 aa), E. coli (CAT#: GPX04-289J)
Recombinant Human herpesvirus 6AEnvelope glycoprotein H (24-694 aa), E. coli (CAT#: GP05-258J)
Recombinant Human herpesvirus 6A Envelope glycoprotein H (17-694 aa), E. coli (CAT#: GP05-263J)
Recombinant Malignant catarrhal fever virus Envelope glycoprotein H (15-733 aa), E. coli (CAT#: GP05-307J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications