Recombinant Human herpesvirus 5 (HHV-5) (strain Merlin) Envelope glycoprotein L (gL) (31-278 aa) [6xHis-GST-tag], E. coli (CAT#: GPX04-204J)

Datasheet

Product Overview	Recombinant Human herpesvirus 5 (HHV-5) (strain Merlin) Envelope glycoprotein L (31-278 aa) was expressed in E. coli with a 6xHis-GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 5 (HHV-5) (strain Merlin)
Fragment	31-278 aa
Sequence	AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR
Tag	6xHis-GST-tag at the N-terminus
Predicted MW	57.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gL
Full Name	Envelope glycoprotein L
Gene ID	3077416
Uniprot ID	F5HCH8
Background	The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.
Alternate Names	Envelope glycoprotein L

Recombinant Human herpesvirus 6A Envelope glycoprotein L (gL) (19-250 aa), Mammalian cell (CAT#: GPX-316-M-J)
Recombinant Murid herpesvirus 1 (strain Smith) (MuHV-1) Envelope glycoprotein L (gL) (18-274 aa), E. coli (CAT#: GPX-322-E-J)
Recombinant Marek's disease herpesvirus type 1 Envelope glycoprotein L (gL) (26-195 aa), Yeast (CAT#: GPX-318-Y-J)
Recombinant Suid herpesvirus 1 (strain Kaplan) (SuHV-1) Envelope glycoprotein L (gL) (17-156 aa), Yeast (CAT#: GPX-320-Y-J)
Recombinant Equine herpesvirus 1 (strain Ab4p) (EHV-1) Envelope glycoprotein L (gL), Baculovirus (CAT#: GPX-254-B-J)
Recombinant HHV-7 (strain JI) Envelope glycoprotein L (gL) (22-246 aa), Yeast (CAT#: GPX-317-Y-J)
Recombinant Equine herpesvirus 1 (strain V592) (EHV-1) Envelope glycoprotein L (gL), E. coli (CAT#: GPX-349-E-J)
Recombinant HHv-4 Envelope glycoprotein L (gL) (23-137 aa), E. coli (CAT#: GPX-003-E-J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications