Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (S) (306-527 aa) [His-Tag], Yeast (CAT#: GP02-107J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (306-527 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Human SARS coronavirus (SARS-CoV)
Fragment	306-527 aa
Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Tag	6xHis-tag at the N-terminus
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	P59594
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E2; Peplomer protein

Recombinant Bat coronavirus RaTG13 Spike glycoprotein (Arg319-Asn542) [His tag], CHO (CAT#: GP05-094J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (G476S) [His-Tag], Mammalian cell (CAT#: GP02-136J)
Recombinant Avian infectious bronchitis virus (strain Beaudette) (IBV) Spike glycoprotein (S), Yeast (CAT#: GPX-111-Y-J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (E484K) [His-Tag], Mammalian cell (CAT#: GP02-122J)
Recombinant Avian infectious bronchitis virus (strain UK/123/82) (IBV) Spike glycoprotein (S), Mammalian cell (CAT#: GPX-261-M-J)
Recombinant Avian infectious bronchitis virus (strain D274) (IBV) Spike glycoprotein (S), Mammalian cell (CAT#: GPX-144-M-J)
Recombinant Human coronavirus HKU1 Spike glycoprotein () [His tag], HEK293 (CAT#: GP05-223J)
Recombinant Avian infectious bronchitis virus (strain M41) (IBV) Spike glycoprotein (S), E. coli (CAT#: GPX-143-E-J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications