There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (306-527 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | Yeast |
Species | Human SARS coronavirus (SARS-CoV) |
Fragment | 306-527 aa |
Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
Tag | 6xHis-tag at the N-terminus |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | S |
Full Name | Spike glycoprotein |
Uniprot ID | P59594 |
Background | Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. |
Alternate Names | S glycoprotein; E2; Peplomer protein |