Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (V483A) [His-Tag], Mammalian cell (CAT#: GP02-137J)

Product Overview	Recombinant Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) Surface glycoprotein [319-541 aa (V483A)] was expressed in Mammalian cell with a 10xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 3 μg/mL can bind SARS-CoV-2-S antibody, the EC50 is 5.13 ng/mL. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability to SARS-CoV-2-S antibody in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 3 μg/mL can bind SARS-CoV-2-S antibody, the EC50 is 5.13 ng/mL.
Source	Mammalian cell
Species	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Fragment	319-541 aa (V483A)
Sequence	RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Tag	10xHis-tag at the C-terminus
Predicted MW	27.8 kDa
Purity	>95%, determined by SDS-PAGE.
Endotoxin Level	<1.0 EU/μg, determined by the LAL method.
Conjugation	Unconjugated

Target	S
Full Name	Surface glycoprotein
Gene ID	43740568
Uniprot ID	P0DTC2
Background	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Alternate Names	Spike glycoprotein