Recombinant Suid herpesvirus 1 (strain Kaplan) Envelope glycoprotein H (gH) (31-686 aa), E. coli (CAT#: GPX04-416J)

Datasheet

Product Overview	Recombinant Suid herpesvirus 1 (strain Kaplan) Envelope glycoprotein H (31-686 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Suid herpesvirus 1 (strain Kaplan)
Fragment	31-686 aa
Sequence	APQGGPPSPQGGPAPTAAPARGPTLFVLVGDGSAWFVFQLGGLGALNDTRIRGHLLGRYL VSYQVVPPPVSAWYFVQRPRERPRLSGPPSGAELVAFDAPGVRRTYTTAAVWPAEVAVLA DAEARCPAAVFNVTLGEAFLGLRVALRSFLPLEVIISAERMRMIAPPALGSDLEPPGPPA GRFHVYTLGFLSDGAMHQTMRDVAAYVHESDDYLAQLSAAHAAALAAVVQPGPYYFYRAA VRLGVAAFVFSEAARRDRRASAPALLRVESDARLLSRLLMRAAGCPAGFAGLFDGRAERV PVAPADQLRAAWTFGEDPAPRLDLARATVAEAYRRSVRGKPFDQQALFFAVALLLRAGGP GDARETLLRTTAMCTAERAAAAAELTRAALSPTAAWNEPFSLLDVLSPCAVSLRRDLGGD ATLANLGAAARLALAPAGAPGAAAATDEGAEEEEEDPVARAAPEIPAEALLALPLRGGAS FVFTRRRPDCGPAYTLGGVDIANPLVLAIVSNDSAACDYTDRMPESQHLPATDNPSVCVY CDCVFVRYSSAGTILETVLIESKDMEEQLMAGANSTIPSFNPTLHGGDVKALMLFPNGTV VDLLSFTSTRLAPVSPAYVVASVVGAAITVGILYALFKMLCSFSSEGYSRLINARS
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gH
Full Name	Envelope glycoprotein H
Gene ID	2952560
Uniprot ID	P27416
Background	The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Alternate Names	Envelope glycoprotein H

Recombinant Marek's disease herpesvirus type 1 Envelope glycoprotein H (18-813 aa), E. coli (CAT#: GP05-313J)
Recombinant HHV-5 (strain AD169) Envelope glycoprotein H (gH), E. coli, Biotin conjugation (CAT#: GPX-145-EB-J)
Recombinant Guinea pig cytomegalovirus (strain 22122) Envelope glycoprotein H (24-723 aa), E. coli (CAT#: GP05-173J)
Recombinant Pseudorabies virus (strain Rice) Envelope glycoprotein H (31-686 aa), E. coli (CAT#: GP05-356J)
Recombinant Human herpesvirus 7 (strain JI) (HHV-7) Envelope glycoprotein H (17-690 aa), E. coli (CAT#: GP05-269J)
Recombinant Human herpesvirus 6A (strain Uganda-1102) Envelope glycoprotein H (gH) (17-694 aa), E. coli (CAT#: GPX04-217J)
Recombinant Marek's disease herpesvirus type 1 Envelope glycoprotein H (19-813 aa), E. coli (CAT#: GP05-312J)
Recombinant Human herpesvirus 6B (strain Z29) Envelope glycoprotein H (gH) (17-694 aa), E. coli (CAT#: GPX04-221J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications