There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (23-188 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | E. coli |
Species | Human herpesvirus 6A (strain Uganda-1102) |
Fragment | 23-188 aa |
Sequence | DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL |
Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
Predicted MW | 26.8 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | gB |
Full Name | Glycoprotein B |
Gene ID | 1487917 |
Uniprot ID | P28864 |
Background | This envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress. |
Alternate Names | gB |