Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein B (gB) (23-260 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-191J)

Datasheet

Product Overview	Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein B (23-260 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 4 (HHV-4) (strain B95-8)
Fragment	23-260 aa
Sequence	QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	43.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gB
Full Name	Envelope glycoprotein B
Uniprot ID	P03188
Background	Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Alternate Names	Envelope glycoprotein B

Recombinant Saimiriine herpesvirus 2 (strain 11) Envelope glycoprotein B (gB) (20-808 aa), E. coli (CAT#: GPX04-402J)
Recombinant Human herpesvirus 2 (strain HG52) Envelope glycoprotein B (gB) (23-279 aa) [His-SUMO], E. coli (CAT#: GP02-041J)
Recombinant Rhesus cytomegalovirus (strain 68-1) Envelope glycoprotein B (gB) (745-854 aa) [His/Myc-Tag], E. coli (CAT#: GP02-042J)
Recombinant Human herpesvirus 7 (HHV-7) (strain JI) Envelope glycoprotein B (gB) (23-259 aa) [6xHis-tag], E. coli (CAT#: GPX04-222J)
Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (gB) (23-188 aa) [His/Myc-Tag], E. coli (CAT#: GP02-040J)
Recombinant Human herpesvirus 1 (HHV-1) (strain Patton) Envelope glycoprotein B (gB) (31-774 aa) [10xHis-tag and Myc-tag], Baculovirus (CAT#: GPX04-179J)
Recombinant HHV-5 (strain AD169) Envelope glycoprotein B (gB), E. coli, Biotin conjugation (CAT#: GPX-146-EB-J)
Recombinant Saimiriine herpesvirus 2 (strain 11) (SaHV-2) Envelope glycoprotein B (20-808 aa), E. coli (CAT#: GP05-379J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications