Recombinant Bovine coronavirus (strain L9) Spike glycoprotein (S) (314-634 aa) [His-Tag], Yeast (CAT#: GP02-112J)

Product Overview	Recombinant Bovine coronavirus (strain L9) Spike glycoprotein (314-634 aa) was expressed in Yeast with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Bovine coronavirus (strain L9)
Fragment	314-634 aa
Sequence	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSCLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag	6xHis-tag at the C-terminus
Predicted MW	36.6 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	P25191
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E18; Peplomer protein; S