Recombinant Rhesus cytomegalovirus (strain 68-1) Envelope glycoprotein B (gB) (745-854 aa) [His/Myc-Tag], E. coli (CAT#: GP02-042J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Rhesus cytomegalovirus (strain 68-1) Envelope glycoprotein B (745-854 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Rhesus cytomegalovirus (strain 68-1)
Fragment	745-854 aa
Sequence	MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	18.0 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gB
Full Name	Envelope glycoprotein B
Uniprot ID	P89053
Background	This protein is an envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Alternate Names	gB; UL55

Recombinant HHV-5 (strain AD169) Envelope glycoprotein B (gB), Baculovirus (CAT#: GPX-146-B-J)
Recombinant Human herpesvirus 1 (HHV-1) (strain 17) Envelope glycoprotein B (gB) (31-284 aa) [10xHis-tag and Myc-tag], E. coli (CAT#: GPX04-168J)
Recombinant Human herpes simplex virus 1 Envelope glycoprotein B (gB) (31-774 aa) [His/Myc-Tag], Mammalian cell (CAT#: GP02-039J)
Recombinant HHV-5 (strain AD169) Envelope glycoprotein B (gB), Yeast (CAT#: GPX-146-Y-J)
Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (gB) (23-188 aa) [His/Myc-Tag], E. coli (CAT#: GP02-040J)
Recombinant Human herpesvirus 1 (HHV-1) (strain Patton) Envelope glycoprotein B (gB) (31-774 aa) [10xHis-tag and Myc-tag], Baculovirus (CAT#: GPX04-179J)
Recombinant Saimiriine herpesvirus 2 (strain 11) Envelope glycoprotein B (gB) (20-808 aa), E. coli (CAT#: GPX04-402J)
Recombinant Human cytomegalovirus (strain AD169) Envelope glycoprotein B (gB) (552-635 aa) [His/Myc-Tag], E. coli (CAT#: GP02-043J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications