Recombinant Human cytomegalovirus (strain AD169) Envelope glycoprotein B (gB) (552-635 aa) [His/Myc-Tag], E. coli (CAT#: GP02-043J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Human cytomegalovirus (strain AD169) Envelope glycoprotein B (552-635 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human cytomegalovirus (strain AD169)
Fragment	552-635 aa
Sequence	TINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRM
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	17.1 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gB
Full Name	Envelope glycoprotein B
Uniprot ID	P06473
Background	This protein is an envelope glycoprotein that plays a role in host cell entry, cell to-cell virus transmission, and fusion of infected cells. May be involved in the initial attachment via binding to heparan sulfate together with the gM/gN complex that binds heparin with higher affinity. Interacts with host integrin ITGB1, PDGFRA and EGFR that likely serve as postattachment entry receptors. Participates also in the fusion of viral and cellular membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL.
Alternate Names	Glycoprotein B

Recombinant Human herpesvirus 1 (HHV-1) (strain Patton) Envelope glycoprotein B (gB) (31-774 aa) [10xHis-tag and Myc-tag], Baculovirus (CAT#: GPX04-179J)
Recombinant HHV-5 (strain AD169) Envelope glycoprotein B (gB), E. coli (CAT#: GPX-146-E-J)
Recombinant Human herpesvirus 4 (HHV-4) (strain B95-8) Envelope glycoprotein B (gB) (23-260 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-191J)
Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (gB) (23-188 aa) [His/Myc-Tag], E. coli (CAT#: GP02-040J)
Recombinant Rhesus cytomegalovirus (strain 68-1) Envelope glycoprotein B (gB) (745-854 aa) [His/Myc-Tag], E. coli (CAT#: GP02-042J)
Recombinant Human herpesvirus 2 (strain HG52) Envelope glycoprotein B (gB) (23-279 aa) [His-SUMO], E. coli (CAT#: GP02-041J)
Recombinant HHV-5 (strain AD169) Envelope glycoprotein B (gB), Yeast (CAT#: GPX-146-Y-J)
Recombinant Saimiriine herpesvirus 2 (strain 11) (SaHV-2) Envelope glycoprotein B (20-808 aa), E. coli (CAT#: GP05-379J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications