Recombinant Cat T-cell-specific surface glycoprotein CD28 (CD28) (21-221 aa), E. coli (CAT#: GPX04-053J)

Product Overview	Recombinant Cat T-cell-specific surface glycoprotein CD28 (21-221 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Cat
Fragment	21-221 aa
Sequence	KILVKQLPRLVVYNNEVNLSCKYTHNFFSKEFRASLYKGVDSAVEVCVVNGNYSHQPQFYSSTGFDCDGKLGNETVTFYLRNLFVNQTDIYFCKIEVMYPPPYIDNEKSNGTIIHVKEKHLCPAQLSPESSKPFWALVVVGGILGFYSLLATVALGACWMKTKRSRILQSDYMNMTPRRPGPTRRHYQPYAPARDFAAYRS
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD28
Full Name	T-cell-specific surface glycoprotein CD28
Uniprot ID	O02757
Background	Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Alternate Names	T-cell-specific surface glycoprotein CD28