There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Human herpesvirus 6A (strain Uganda-1102) Putative immediate early glycoprotein (NP_042911.1) (22-293 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Human herpesvirus 6A (strain Uganda-1102) |
| Fragment | 22-293 aa |
| Sequence | SNFTCEQKIVLIQEHKLRSICISTCYVNGVLAGNSSCVSVKTSYLINLAMLTNGFKAMRV GNITSISEKTAFLRVIINYYFRGVMLRALIAQRLPNAANLSSTVNCWLDDHSAGGVMTLF YGTERIVLNSSTEINASRWISDGQDANGTLNILNERVSLDIYFLSKICPQLSSEIYKKKV AHPKYFSLIKNDTKPKKFLRNTWRSAWSNWYKYKEIKEFLDFSSDYENFSEITYSMSAAG LFFLAGGAFTMLLLLCCLSMITRKHIVKDLGY |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | U18 |
| Full Name | Putative immediate early glycoprotein |
| Gene ID | 1487934 |
| Uniprot ID | Q69553 |
| Accession Number | NP_042911.1 |
| Background | Human herpesvirus 6 (HHV-6) is the common collective name for human betaherpesvirus 6A (HHV-6A) and human betaherpesvirus 6B (HHV-6B). Human herpesvirus-6 (HHV-6) A and B are ubiquitous betaherpesviruses, infecting the majority of the human population. |
| Alternate Names | Protein U18 |