Recombinant Human metapneumovirus (HMPV) (strain CAN97-83) Major surface glycoprotein G (G) (1-219 aa), E. coli (CAT#: GPX04-227J)

Product Overview	Recombinant Human metapneumovirus (HMPV) (strain CAN97-83) Major surface glycoprotein G (1-219 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human metapneumovirus (HMPV) (strain CAN97-83)
Fragment	1-219 aa
Sequence	MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSS ESEHHTSSPPTESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPAST PDTTNRLSSVDRSTAQPSESRTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMS STGKRPTTTSVQSDSSTTTQNHEETGSANPQASVSTMQN
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	G
Full Name	Major surface glycoprotein G
Gene ID	21011770
Uniprot ID	Q6WB94
Background	Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
Alternate Names	Major surface glycoprotein G